Recombinant Human Serpin A12 Protein(N-GST)

Recombinant Human Serpin A12 is produced by our E.coli expression system and the target gene encoding Leu21-Lys414 is expressed with a GST tag at the N-terminus.

Serpin A12蛋白；Vaspin蛋白;Serpin A12; OL-64; Visceral Adipose Tissue-Derived Serine Protease Inhibitor; Vaspin; Visceral Adipose-Specific Serpin; SERPINA12

Human

Escherichia coli.

Supplied as a 0.2 μm filtered solution of 50mM TrisHCl, 160mM NaCl, 0.2mM PMSF, 1mM DTT, 10% Glycerine, pH 7.2 .

Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.

MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSLKPSFSPRNYKALSEVQGWKQRMAAK

N-GST

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Vaspin (Visceral Adipose-Specific SERPIN) is a newly described adipokine. Vaspin has three β-sheets, nine α-helices, and one central loop; the structure is part of the set of distinctive features that are descriptive of Serpin family members. Vaspin is also a unique insulin sensitizing adipocytokine in obesity. A recent publication indicates that Vaspin mRNA expression in visceral fat is positively correlated with BMI and percent of body fat. and could be associated with parameters of obesity, insulin resistance, and glucose metabolism. These findings suggest a potential clinical use for Vaspin in ameliorating certain aberrations seen in the obesity metabolic syndrome.

Q8IW75