Recombinant Human CCL3L1 Protein(C-6His)

Recombinant Human C-C Motif Chemokine 3-Like 1 is produced by our Mammalian expression system and the target gene encoding Ala24-Ala93 is expressed with a 6His tag at the C-terminus.

CCL3L1蛋白;C-C Motif Chemokine 3-Like 1; G0/G1 Switch Regulatory Protein 19-2; LD78-Beta(1-70); PAT 464.2; Small-Inducible Cytokine A3-Like 1; Tonsillar Lymphocyte LD78 Beta Protein; CCL3L1; D17S1718; G0S19-2; SCYA3L1; CCL3L3

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

APLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSD LEPSAVDHHHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

C-C Motif Chemokine 3-Like 1 (CCL3L1) is a secreted protein that belongs to the intercrine beta (chemokine CC) family. CCL3L1 is a ligand for CCR1, CCR3 and CCR5. CCL3L1 binds to several chemokine receptors including chemokine binding protein 2 and chemokine (C-C motif) receptor 5 (CCR5). CCR5 is a co-receptor for HIV, and binding of this protein to CCR5 inhibits HIV entry. The processed form LD78-beta (3-70) shows a 20-fold to 30-fold higher chemotactic activity and is a very potent inhibitor of HIV-1-infection. The copy number of this gene varies among individuals: most individuals have 1-6 copies in the diploid genome, although rare individuals have zero or more than six copies. The human genome reference assembly contains two full copies of the gene (CCL3L3 and CCL3L1) and a partial pseudogene. This record represents the more centromeric full-length gene.

P16619