Recombinant Human TNFRSF25 Protein(C-Fc)

Recombinant Human Death Receptor 3 is produced by our Mammalian expression system and the target gene encoding Gln25-Phe201 is expressed with a Fc tag at the C-terminus.

Death Receptor 3蛋白；DR3蛋白；TNFRSF25蛋白;Tumor necrosis factor receptor superfamily member 25; APO3; DDR3; DR3; TNFRSF12; WSL; WSL1; TNFRSF25; Protein WSL-1; LARD; Protein WSL; Lymphocyte-associated receptor of death; Death receptor 3; Apoptosis-mediating receptor TRAMP; Apoptosis-inducing receptor AIR; Apoptosis-mediating receptor DR3; Apo-3

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCPQDTFLAWENHHNSEC ARCQACDEQASQVALENCSAVADTRCGCKPGWFVECQVSQCVSSSPFYCQPCLDCGALHRHTRLL CSRRDTDCGTCLPGFYEHGDGCVSCPTSTLGSCPERCAAVCGWRQMFVDDIEGRMDEPKSCDKTH TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDG

C-Fc

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Tumor necrosis factor receptor superfamily member 25 (TNFRSF25) contains 1 death domain and 4 TNFR-Cys repeats. TNFRSF25 is a cell surface receptor of the tumor necrosis factor receptor superfamily which mediates apoptotic signalling and differentiation, activated by a monogamous ligand, known as TL1A (TNFSF15), which is rapidly upregulated in antigen presenting cells and some endothelial cells following Toll-Like Receptor or Fc receptor activation. This receptor has been shown to signal both through the TRADD adaptor molecule to stimulate NF-kappa B activity or through the FADD adaptor molecule to stimulate caspase activation and regulate cell apoptosis. It may play a role in regulating lymphocyte homeostasis.

Q93038