Recombinant Human PDGF-AA Protein

PDGF-AA蛋白;Platelet-derived growth factor subunit A; PDGF subunit A; PDGF-1; Platelet-derived growth factor A chain; Platelet-derived growth factor alpha polypeptide; PDGFA; PDGF1

Human

Escherichia coli.

Lyophilized from a 0.2 μm filtered solution of 20mM Glycine-HCl, 6% Sucrose, 4% Mannitol, 0.02% Tween 80, pH 3.0.

Lyophilized protein should be stored at≤-20°C, stable for one year after receipt. Reconstituted protein solution can be stored at 2-8°C for 2-7 days. Aliquots of reconstituted samples are stable at ≤-20°C for 3 months. 

SIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVK VAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDTGRPRESGKKRKRKRLKPT

No Tag

Greater than 90% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 EU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100μg/ml. Dissolve the lyophilized protein in distilled water. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Platelet-derived growth factor subunit A (PDGFA), belongs to the PDGF/VEGF growth factor family. PDGFA is a secreted protein, stored in platelet alpha-granules and released by platelets upon wounding. PDGFA is potent mitogens for a variety of cell types including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. It plays an essential role in the regulation of embryonic development, cell proliferation, cell migration, survival and chemotaxis. PDGFA is required for normal lung alveolar septum formation during embryogenesis, normal development of the gastrointestinal tract, normal development of Leydig cells and spermatogenesis, normal oligodendrocyte development and normal myelination in the spinal cord and cerebellum. It plays an important role in wound healing; Signaling is modulated by the formation of heterodimers with PDGFB.

P04085