Recombinant Human proHB-EGF Protein(C-6His)

Recombinant Human Heparin Binding EGF like Growth Factor is produced by our Mammalian expression system and the target gene encoding Leu20-Leu148 is expressed with a 6His tag at the C-terminus.

proHB-EGF蛋白;Diphtheria toxin receptor; DTR; HEGFL; heparin-binding EGF-like growth factor; DTS; DTSF; heparin-binding epidermal growth factor; proheparin-binding EGF-like growth factor; HB-EGF; pro HB-EGF

Human

Human Cells

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

LVTGESLERLRRGLAAGTSNPDPPTVSTDQLLPLGGGRDRKVRDLQEADLDLLRVTLSSKPQALA TPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSLH HHHHH

C-6His

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH4O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Heparin-binding EGF-like growth factor (HB-EGF) is a 12­16 kDa member of the epidermal growth factor (EGF) family. It possesses an EGF­like domain, and a heparin-binding motif. Mature HB­EGF is a soluble peptide that arises from proteolytic processing of the transmembrane form. Human HB­EGF shows 76% and 73% aa sequence identity with rat and mouse HB­EGF, respectively. It is required for normal cardiac valve formation and normal heart function, promotes smooth muscle cell proliferation. It may be involved in macrophage-mediated cellular proliferation; it is mitogenic for fibroblasts, but not endothelial cells. HB­EGF classified as a group 2 ErbB ligand based on its ability to activate both the EGF/ErbB1 and ErbB4 receptors. Activity associated with ErbB4 binding appears to be limited to non­mitogenic actions, while EGFR binding induces both mitogenic and non­mitogenic activity.

Q99075