Recombinant Rat CSF1 Protein

M-CSF蛋白；CSF1蛋白;Macrophage colony-stimulating factor 1; CSF-1; M-CSF; MCSF; CSF1

Rat

Human Cells

Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH7.4.

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

EVSEHCSHMIGNGHLQILQQLIDSQMETACLIEYKFVDQEQLDDPVCYLKKAFVLVQVIIEETMR FKDNTPNANATERLQELSMKLNSCFIKDYKEQNEACVQTYKESPLRLLEKIKNFFNETKNFLEKD WNIFSKNCNDSFAKCSSRDVVTKPDCNCLYPKATPSSDLASASPHQPPAPSMAPLADLAWDDSQR TEGSSLLPSDLPLRIEDPGSAKQRPPR

No Tag

Greater than 95% as determined by reducing SDS-PAGE.

Less than 0.1 ng/μg (1 IEU/μg) as determined by LAL test.

Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Rat Macrophage colony-stimulating factor 1(MCSF,CSF1) is a single-pass type I membrane cytokine. It is a hematopoietic growth factor that plays an essential role in the regulation of survival, proliferation and differentiation of hematopoietic precursor cells, especially mononuclear phagocytes, such as macrophages and monocytes. MCSF promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. It is involved in the regulation of osteoclast proliferation and differentiation, the regulation of bone resorption, and is required for normal bone development which for normal male and female fertility. It promotes reorganization of the actin cytoskeleton, regulates formation of membrane ruffles, cell adhesion and cell migration. MCSF also plays a role in lipoprotein clearance.

Q8JZQ0